NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211708_10046324

Scaffold Ga0211708_10046324


Overview

Basic Information
Taxon OID3300020436 Open in IMG/M
Scaffold IDGa0211708_10046324 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1672
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_072
CoordinatesLat. (o)-8.7788Long. (o)-17.9098Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054157Metagenome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0211708_100463241F054157N/ARETRKQNLETGKWNYRELMNGMTAWSTNPDYAEIIIQAIVDNKLP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.