Scaffold Ga0211576_10067123

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211576_10067123

Scaffold Ga0211576_10067123

Overview

Basic Information
Taxon OID	3300020438 Open in IMG/M
Scaffold ID	Ga0211576_10067123 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2022
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (28.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_133
Coordinates	Lat. (^o)	35.4118	Long. (^o)	-127.7122	Alt. (m)		Depth (m)	45
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001411	Metagenome / Metatranscriptome	701	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211576_100671236	F001411	N/A	MKDKRTYTHLKEHGEDMSHENESKTKLSEDRGPGDLSLLVELHKKEIWDWKQKESEWVKTENLLSGTKKIIDEMGAKIIQQVAVIKALEHDNEVYKKEIEKLLAEKNK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.