NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211518_10047753

Scaffold Ga0211518_10047753


Overview

Basic Information
Taxon OID3300020440 Open in IMG/M
Scaffold IDGa0211518_10047753 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2470
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_025
CoordinatesLat. (o)39.3599Long. (o)19.4084Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001656Metagenome / Metatranscriptome656Y
F016994Metagenome / Metatranscriptome243N

Sequences

Protein IDFamilyRBSSequence
Ga0211518_100477531F016994AGGAGGMTTENNTTFVAAADSLLGKELEFITIDAGEELANHQLKNETQNAIENTVRVYGNIVGAGPLFDTNASRTYIVEGTDMFVGSPASAGGSFTLTESGADGSSVGTLLAAIKALGTVDGIDLNDGGTTAKIENLEL
Ga0211518_100477533F001656AGGAGMPITRNRSGDLTRRQSFNGKGLTFVEVIFAQSVDGATTPEALDSVFDKVTKVVNKNGTLLGASYRLAAKATDNDAAEASEITANDSIDSFQFVVEGTPGQFNAADSAGDINMDVDATVVGDAEADIEADIRAVLDGDSSNNTQHVKVRTLLPEGHVNGDANTFVGMFDQRGDA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.