Scaffold Ga0211559_10227589

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211559_10227589

Scaffold Ga0211559_10227589

Overview

Basic Information
Taxon OID	3300020442 Open in IMG/M
Scaffold ID	Ga0211559_10227589 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	877
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_140
Coordinates	Lat. (^o)	7.416	Long. (^o)	79.3102	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095597	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211559_102275891	F095597	N/A	PYRRLQERVKELEDISKAHQKQNGDLHLKIADLETVINLLKDRLETTEEPLRQLCHIVKVSNYFENIRATQMKQARDIVDINYVP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.