NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211641_10006529

Scaffold Ga0211641_10006529


Overview

Basic Information
Taxon OID3300020450 Open in IMG/M
Scaffold IDGa0211641_10006529 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6986
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_111
CoordinatesLat. (o)-16.9554Long. (o)-100.6925Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010848Metagenome / Metatranscriptome298Y
F023113Metagenome / Metatranscriptome211Y
F047067Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0211641_100065293F023113AGGAMPKKNEPNQEISAKPKLYVEDGNIEAHIIADMLRIESITAELKEFKDVTKSRLDKLENWIVAIVGLTFTTLVTTVVGLLMKLLXE
Ga0211641_100065296F010848AGGAGMVQSRDNGNVASIENIGKDVFLKSFQRQAGNISQSQLDSLVAEIQNLNLSVLTVGSFTPDTQNTVKLIVEGADNLANGDIAGHVIGDVTF
Ga0211641_100065297F047067AGGAGMAQSKGNGAGVADFTAGTLIQKHNVVAIKVDTGADLRNDDDSTREAVERALQFIQPLAYEVKDNNSGEIHAIVDGSQFDAAALQAQIRAIGSITDPTTYNFSSAAVTAGSSLTVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.