Basic Information | |
---|---|
Taxon OID | 3300020453 Open in IMG/M |
Scaffold ID | Ga0211550_10163134 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1049 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_149 | |||||||
Coordinates | Lat. (o) | 34.0491 | Long. (o) | -49.8315 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036273 | Metagenome / Metatranscriptome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211550_101631341 | F036273 | N/A | YFPKTKIEETASKDEVDSVAANAPTLESNTDAMAAYTAAITKNIKSVKV |
⦗Top⦘ |