NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211664_10012560

Scaffold Ga0211664_10012560


Overview

Basic Information
Taxon OID3300020455 Open in IMG/M
Scaffold IDGa0211664_10012560 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4399
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (36.36%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_100
CoordinatesLat. (o)-12.9226Long. (o)-96.0932Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024886Metagenome / Metatranscriptome204Y
F031892Metagenome / Metatranscriptome181Y
F084085Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0211664_100125602F031892N/AMTSLEFNVLVDELDSYAQQTMNKKGPEYTTGNEDVLNNFKATAKKLGVDPLVIWYAYFDKQVSSVAAHVSNEDLNKAEPMISRFGDIINYAKLGYALFSERDNL
Ga0211664_100125603F084085GAGMMCKDVMMTLLSLIEKEMKRRIEHSYFEEESDKWSKFHSWIREIRLTINKGGIK
Ga0211664_100125607F024886N/AMSRKFKNEVTFKVSVDVNGKQEYNFMERNYDKLCDKLTDIMIRETL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.