Scaffold Ga0211486_10019567

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211486_10019567

Scaffold Ga0211486_10019567

Overview

Basic Information
Taxon OID	3300020460 Open in IMG/M
Scaffold ID	Ga0211486_10019567 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3388
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_032
Coordinates	Lat. (^o)	23.4217	Long. (^o)	37.2517	Alt. (m)		Depth (m)	80
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022211	Metagenome / Metatranscriptome	215	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211486_1001956711	F022211	N/A	MRTAPTETVPHIHKGEMTMMDTQINYSDEMMRFRRDAILSLKEFGFGKDIYEFCSDWVLNHETTQGIREAFKEYETQRPNQINQIST

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.