NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211640_10001647

Scaffold Ga0211640_10001647


Overview

Basic Information
Taxon OID3300020465 Open in IMG/M
Scaffold IDGa0211640_10001647 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14233
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_111
CoordinatesLat. (o)-16.9687Long. (o)-100.7324Alt. (m)Depth (m)90
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093943Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0211640_100016476F093943GGAGGMARTKQYVVYTREFVKGNVKNKVGVFLDEAKNSLDAKGNVNGGVIKYKNLKMKRTTPTTNLINKGYDFSVRVIGTGNYQVAKGMKNSVIALLQDNGKTLINKVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.