NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211579_10043174

Scaffold Ga0211579_10043174


Overview

Basic Information
Taxon OID3300020472 Open in IMG/M
Scaffold IDGa0211579_10043174 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2828
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_132
CoordinatesLat. (o)31.4813Long. (o)-159.088Alt. (m)Depth (m)115
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001711Metagenome / Metatranscriptome648Y
F020921Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0211579_100431747F020921AGGMALPKVPTTNVGIYNHLRVSTDCNETTNLSLGSLCNGGDIGGIDHTFGGAGGPAKDFDVIGGTNNPITTTADSTNLYDDVIGVAPYNLANCIGGQYT
Ga0211579_100431748F001711N/AKIAEKAVESASSPKQVEIKHLRSMKDEAGKDVSVVDWTETKGVDEAISQAEAELVNAEARVTELKADIVEYKKIKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.