Scaffold Ga0211585_10023891

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211585_10023891

Scaffold Ga0211585_10023891

Overview

Basic Information
Taxon OID	3300020477 Open in IMG/M
Scaffold ID	Ga0211585_10023891 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4984
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (69.23%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_125
Coordinates	Lat. (^o)	-8.9103	Long. (^o)	-142.5767	Alt. (m)		Depth (m)	140
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094391	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211585_100238913	F094391	GGAG	MKKDVSYKVPKISNNTDKGKWLNSFVGKFFTGSHNYNFDGKIHVKLKTTQFKMNNDLSVMVAWFKNLKKLKQDQFVGEVFKAQLYRNNLKEAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.