NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211585_10028969

Scaffold Ga0211585_10028969


Overview

Basic Information
Taxon OID3300020477 Open in IMG/M
Scaffold IDGa0211585_10028969 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4398
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_125
CoordinatesLat. (o)-8.9103Long. (o)-142.5767Alt. (m)Depth (m)140
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000245Metagenome / Metatranscriptome1468Y
F000659Metagenome / Metatranscriptome952Y
F002715Metagenome / Metatranscriptome535Y

Sequences

Protein IDFamilyRBSSequence
Ga0211585_100289692F002715AGGAMAEELSDVKLEVGLLKNEVEARGKQTETLLQKLDLTADKLQQLTVQIIKLNTRQEDHLKHDNTVRDELKILHQRIGDLHDKQLSAHKEVERRLDRLDQYKSKLMGMIVVIGGALGIIVAFATHFLN
Ga0211585_100289694F000245N/AMKTFSRLREGGLDDKLDKYVSDEIKKRKLARFPVNATDDWKMLKGKPDFKFPSPTGAMMIHVYLRNMSRIKGKIPKDMKAFNYTLEDK
Ga0211585_100289695F000659GAGMKTFSKYLGENSKYIVSKNPNDKKWYVMGHVGRNKWMPVSNGFKNKAQAQKWAKSQDKVDDAARGEIGDV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.