NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211585_10033563

Scaffold Ga0211585_10033563


Overview

Basic Information
Taxon OID3300020477 Open in IMG/M
Scaffold IDGa0211585_10033563 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3998
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_125
CoordinatesLat. (o)-8.9103Long. (o)-142.5767Alt. (m)Depth (m)140
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003679Metagenome / Metatranscriptome474Y
F097476Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0211585_1003356311F097476AGGAGGMDLKKINEQLKPKKPDLYSPTNRYGVMGLALGGDLHSRLKSYATKNNLKMGQIIKLLVKSYLDEMENNGNIXNKISFTKFFKG
Ga0211585_100335633F003679AGCAGMYKQKFTGSIQQEHIKWWKPYWIKPILLEILYPKQGWITLVKVFREGKPSVRVITRPTSSDKRELLVLKNNYGGNKWN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.