NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208201_100644

Scaffold Ga0208201_100644


Overview

Basic Information
Taxon OID3300020480 Open in IMG/M
Scaffold IDGa0208201_100644 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3162
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027823Metagenome / Metatranscriptome193Y
F038204Metagenome / Metatranscriptome166N
F041755Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0208201_1006443F038204N/AMNKDIEFNGDDLVKSVESFASTLPTKIEYFEWGNYGWGIILRQNINTSDKKYISHTDDSVTFTDSFTDIYYETQYHDVTHTRKFNVIRDELIASHKKKIEELQKEVDILEASDTFDKYHDIVYKK
Ga0208201_1006447F041755N/AMNITAAKISGKEIDAKYPILNTKWKYSHYKGDWNGYNGYYYSNYKDWSTEVVTDPWYRNLINNGNPINTTESESIFFTSVEGNKVILVIYLKTYV
Ga0208201_1006448F027823N/AMNITAAINIPCVSQTNLWKGCFEAHFMSGREIDVKYPILNTKWKYSHHKLRGVYDDYDGYYYAYEKDIGTGIMFDPWLREFKVNMTISDGVYKTKMYHTTVESNPILLVLYKKKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.