NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208484_1000847

Scaffold Ga0208484_1000847


Overview

Basic Information
Taxon OID3300020504 Open in IMG/M
Scaffold IDGa0208484_1000847 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 09AUG2011 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6638
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017597Metagenome / Metatranscriptome239N
F019778Metagenome / Metatranscriptome227N
F024477Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0208484_10008472F019778N/AMSSNVASQAELIFLYIGESRLIKRISSDILLVLHEDAKSINTIKMKELLQFKIRGRLSYLHHLAMSTVREEAKYASALYTQLDSLLAILSSDDKVTAIKLITKICSAYRASKETVQSTAQTSDNIEKMEIG
Ga0208484_10008473F017597N/AMKKNFWSEKLLIKLAIKRKELIKITKSSKSTLIKTEMITRILITALKAKQIIAIRFQVNRTNNLQIWGQKS
Ga0208484_10008474F024477N/AVSYDIIRNSSKTSSFELLIKNITLIEKVEDFYKELDQITNYRFNCHRKPDPDIYFMKDIIKIRLMELKRLQTQKTNELIKLSQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.