NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208202_1005724

Scaffold Ga0208202_1005724


Overview

Basic Information
Taxon OID3300020514 Open in IMG/M
Scaffold IDGa0208202_1005724 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1800
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013886Metagenome / Metatranscriptome267N
F090299Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0208202_10057242F090299AGGMKKVIVSKVEYEFLVSLLEELYIISPDETISDKWISKLEPTKKLFDLELEFYNIRNDNQTPTKKEMIKWLLEKIKNKNLDL
Ga0208202_10057243F013886N/AMNNQDKPNAFAFKAKVGESKEIQLCICIRENDKWLENEIFSVPEGHPELSPYIDEQLFNIVFIGYERDENKEGFWIKHQNSFYMKSDTILTEDLLNNGEFFTTIEKGYQSFYEQSITSEREGEQTSSSEQENL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.