NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208232_1017219

Scaffold Ga0208232_1017219


Overview

Basic Information
Taxon OID3300020527 Open in IMG/M
Scaffold IDGa0208232_1017219 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1062
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002357Metagenome / Metatranscriptome567Y
F003825Metagenome / Metatranscriptome466Y
F013521Metagenome / Metatranscriptome270Y
F055535Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0208232_10172191F013521GAGMTSFKCNGCARKTEFLWLDAIDMPDGFKVYQCMDCG
Ga0208232_10172192F003825N/AVGYIAIINGSGFTVEIDDNGAHIVKSVITCEMCGDDRVFKNGTCFVCSELIKHD
Ga0208232_10172193F002357AGGAMGFNLEDYEDVATLNKWFIANFPMGRSDISVVSHDATNGYILIQATLWRDSTDDKPAASNLAFGSRETFMPNMKKWYVEDTASSALGRAIILLKGSNKTATKDDMKRVETSEPNQYEKKLQERRYGAPGTKSAAIEDALRASFAVENKVDDPQQWTIADAVDAVGHTTPKEPPMCEHGMILKQGVSKGGKPYYGYVCKGSNKDHAVWAKMTAKGTFYFDGVE
Ga0208232_10172194F055535N/AKVSRLTETPDHYDSVKDFIAYGAIYRNVLEAVQDQDFEWKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.