NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208235_1000108

Scaffold Ga0208235_1000108


Overview

Basic Information
Taxon OID3300020530 Open in IMG/M
Scaffold IDGa0208235_1000108 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22312
Total Scaffold Genes40 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (67.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014121Metagenome / Metatranscriptome265Y
F017818Metagenome / Metatranscriptome238Y
F083877Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0208235_100010810F083877GGAGMTEFYVIMLKRQDGKVYADLHKTTQDIYLTIEDAYEEWNNTEHYKEYYHIVKLIASCEDE
Ga0208235_100010813F017818AGGAMNKDAYYDWIDENDSYPEHSHKWIVGLYNKYEGVEALHRYFGTFDTREEAKVFAADYKDKYTKTGFISSVKVFPLCSIVE
Ga0208235_10001082F014121N/AMTDTAYKIWETFKAELTQPATDDMKQALASSIRVISSLIERDGVLENEPWHLHIADELNELSYDVEAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.