NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208596_1002155

Scaffold Ga0208596_1002155


Overview

Basic Information
Taxon OID3300020534 Open in IMG/M
Scaffold IDGa0208596_1002155 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4805
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (30.77%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001840Metagenome / Metatranscriptome627Y
F007169Metagenome / Metatranscriptome356N
F022862Metagenome / Metatranscriptome212N

Sequences

Protein IDFamilyRBSSequence
Ga0208596_100215512F001840N/AMKEEKDSAFLICDCFSHGLLVEKFEGEEEVHLSLFERGMDGRILRWSERLRWCWQILRYGKLWSDFIILNTENQKRLKEFLENK
Ga0208596_10021553F007169N/AMSYQLQFDFETLEQKEKRLKGWHDQQVKLNKMFEGKANDYYIYNKYVDQFIDFLPYRLGWGLRGNYNELRWWIKCQYQKFRYGVSDDEVYSLETNIAKYMVPRLQYFKKKGKMGIPMKFLPSNYDNLQDEDREKAEKIGEKEINRILDEMIFAFDYIIDPDKYVTFPKSCSWDIKDKNYFNREKSLEAKQAWDEYTKTCDQLETRKKQGLQLFVDHMDMLWI
Ga0208596_10021555F022862N/AMKFTPQQYELICKTRDEIRDLNSKQHALYDNLTKELNITIYAEDWLFDYIYNEYGSIDDIEARM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.