NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208359_1001024

Scaffold Ga0208359_1001024


Overview

Basic Information
Taxon OID3300020541 Open in IMG/M
Scaffold IDGa0208359_1001024 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5185
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000450Metagenome / Metatranscriptome1126Y
F018349Metagenome / Metatranscriptome235Y
F023344Metagenome / Metatranscriptome210Y

Sequences

Protein IDFamilyRBSSequence
Ga0208359_100102411F023344AGGGGGMEAFTDTVGEHILGAIQVDIEQHLFEQWNNANLEEGSAYAEYRFMQFAPDNLKQSYNEYYGYIEGDEFLL
Ga0208359_100102414F000450GGCGGMGDRANFVFVDSKGDSIVLYGHWAGHNMLANLADAVAKARSRWTDTTYATRIAISQLVGDQWNMETGWGLSVNSISDNEHRIPVIDFNQQTFSLHEEDDWANTQNKVRGMKNEAIFTQDLTTFCEKYSDQLVSV
Ga0208359_100102416F018349AGGAGVDYQDGFQDGVKFSREVIINNIRKWAEDHDEGATLDWVADRIEFGTLDNDI
Ga0208359_100102417F000311AGGTGGMYFELTAPDRLSMEMAYWDAQITGLDPQAMSPLTFNIGTGSIEKVSRLRDKFNLIESYVSDHEPTGYLRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.