NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208359_1005983

Scaffold Ga0208359_1005983


Overview

Basic Information
Taxon OID3300020541 Open in IMG/M
Scaffold IDGa0208359_1005983 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2165
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027496Metagenome / Metatranscriptome194N
F031464Metagenome / Metatranscriptome182N
F099211Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0208359_10059832F027496N/AMTKDMLDELLYLIELQIKANIALALGHADAADKEAEKEHVQYYRLVSLIDSMRDDLK
Ga0208359_10059834F099211AGTAGGMKGLFEMYPDDEFLPEEAFDEITKGEYEDMMEDHNVNDVLNRFVRLCQEYGFYFMMRQLTKALNAKGFNV
Ga0208359_10059835F031464AGGMRKRIQPRKRKVNPYVAYLENHGRHATLEDLLEAFPDKTSKQIRDSMSKLVDNYTVDRDIRKDDHQYLISYSLGGYNTRDNTGICWHNPFNLRTT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.