NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208360_1005700

Scaffold Ga0208360_1005700


Overview

Basic Information
Taxon OID3300020551 Open in IMG/M
Scaffold IDGa0208360_1005700 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1918
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F013878Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0208360_10057001F000671GAGGMEKILCYSCNKSKNKLDVKKSSLLPINLFICETCSSSKFEPRWVIILAGRSQGPDHVKEYIVKRRYIGNEISASELLV
Ga0208360_10057003F000473GAGGMFINKKDINEHFKYGVNEWTGEPNKPVFYTEEMKKAVHQVKKPPMLLMDIVMYPDFLALRLYEDNFLQFEGTKKEMVIDYVGKIKRLLESYGVRCELEGKPSEKVL
Ga0208360_10057005F013878AGGMLNLTELGVEVFMKKAKYVTPFWDNYDLVIWKKDINGFTNVKGMFKENTWGTAERISVDSDGIWKLPTKHVKHFK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.