NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207940_1003051

Scaffold Ga0207940_1003051


Overview

Basic Information
Taxon OID3300020552 Open in IMG/M
Scaffold IDGa0207940_1003051 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4036
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010464Metagenome / Metatranscriptome303N
F014844Metagenome / Metatranscriptome259Y
F059754Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0207940_10030513F010464GAGMNLIETTIVGSVAAIVGGAVAWFTKGRVESDSLQVRQAQAVLAMWQATSESQNKELTQLRNEVVSLRQRLEEMEHTIHALQAENAKLKTLV
Ga0207940_10030517F014844N/AMLIGYGYGYPTNMLQGGVAAGVWALFNARATADGATAAEAAVDGCLFNHFAVIYNF
Ga0207940_10030519F059754N/APTLGWQDNEDEVLSDQLQIAQDFISSLTNDPSEDWTLSSSVSLTRFVESRDDRTAGWQATMTFEIPFGHSVCEIPT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.