NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208599_1012392

Scaffold Ga0208599_1012392


Overview

Basic Information
Taxon OID3300020554 Open in IMG/M
Scaffold IDGa0208599_1012392 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1436
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001834Metagenome / Metatranscriptome628Y
F020512Metagenome / Metatranscriptome223Y
F054664Metagenome / Metatranscriptome139N

Sequences

Protein IDFamilyRBSSequence
Ga0208599_10123921F020512N/AAGGGQIEGVDFSPTPFRMGRSLFNKCVGLLGSYMDTEGMAQ
Ga0208599_10123922F001834AGGMPNETILQQIRTPLATALSSVAGNVYSFVPETVIPPAVVVVPDSPYLEIETIGKSRIRTRINMTITAVVAYNSNPASLDNIEQLIMSILAVIPNGYIVGEVERPTVTTIGASTMLISDIRVSTYYEQTI
Ga0208599_10123925F054664GGAGMANETIAYNKKDLRDIYKAFKLMDDQATEEARRQSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.