NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208465_1000637

Scaffold Ga0208465_1000637


Overview

Basic Information
Taxon OID3300020570 Open in IMG/M
Scaffold IDGa0208465_1000637 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8965
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (75.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F002060Metagenome / Metatranscriptome597Y
F040629Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0208465_10006372F040629N/AMNKYTVKLEVVAEVEAFDEDDAKDYITDIFGTDDEIKSIKITSIKEK
Ga0208465_10006375F000473AGGMPSNLYNDKHFKHGINLWTGEPNKPVFYNEEMRKKLREIKKPLLLMMDVVKYPEFLALRLYEDNFIQFTGSKKEEVIDYVAKVKKMIESYGVRCELEGVPGGRTIT
Ga0208465_10006378F002060N/AMEINYVTVVLSLLAAILSGMGTAIIAGLRDSKKEKIRREERDKDHLKLEVKDLKIELYKLEKELTEWKDKYYEAIQELISLKAELENALTTLSHIEMHENLDSEYLK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.