NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208053_1015710

Scaffold Ga0208053_1015710


Overview

Basic Information
Taxon OID3300020575 Open in IMG/M
Scaffold IDGa0208053_1015710 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1509
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F003690Metagenome / Metatranscriptome473Y
F008132Metagenome / Metatranscriptome338Y

Sequences

Protein IDFamilyRBSSequence
Ga0208053_10157102F008132AGGMTKWDTIQADVADAYIHLDEVEDVEQEDEQDFFGFSKAIQLDHLTDEQLDEVFNMFGDK
Ga0208053_10157103F003690N/AMTISGVILELNEYGLEFDSFLGAIYLPWHSIAIATALLIAYKIYKRKKNK
Ga0208053_10157105F001562AGGAGMTQFERDLTIKESFIDLLNDIYPNVKIGYSTFTPAEILECCDPVAFSIGVIEHEDYMLECGMLDDEEM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.