NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210395_10000241

Scaffold Ga0210395_10000241


Overview

Basic Information
Taxon OID3300020582 Open in IMG/M
Scaffold IDGa0210395_10000241 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42828
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (69.44%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000043Metagenome / Metatranscriptome3655Y
F000742Metagenome / Metatranscriptome912Y
F030510Metagenome / Metatranscriptome185Y
F097717Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0210395_1000024119F030510GGAVAAEDRTDAGSIRNAIRWGLLLASLATAGFRLPRLVNEYRAWRDALGLGDSSASEGWHRVLTVELIGVLVVLAIGIAVFYALRPKGKAAE
Ga0210395_1000024120F000043GGAMIYQLGWTTLPGLRGLSVSDFRRTATDTPDTTSGVAIECGSGTECDAFLKQLEEHFGPRRFSNAADAFDSVKAYVLEYAAKR
Ga0210395_1000024127F097717AGGAGMRHRTKSSFFGKTLLLGATLAGTLMLSGAPQLRADDDCQKRIAKADHELHKAAQDHGWDSPQAADRRRELAAAREWCWEHGRRWWDEDAQKWHTEHDWDEHDHDHPPR
Ga0210395_100002417F000742N/AMTSRALAVLACAVLLYFAAGGSLLHQHTGGPENACHICQSLHAPVLAAASLDLVVVPELISRYTSLPQHIAPSNSFSLDRASRAPPSA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.