Scaffold Ga0211540_1010311

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211540_1010311

Scaffold Ga0211540_1010311

Overview

Basic Information
Taxon OID	3300020584 Open in IMG/M
Scaffold ID	Ga0211540_1010311 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555983-ERR599011)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1418
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_041
Coordinates	Lat. (^o)	14.5	Long. (^o)	70.0	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023136	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211540_10103114	F023136	GAG	MNVIERKAIIRKDKNTTPKDFRLDLKFNICFVDIIKEANIQNCVRKIIGKTKSGVTAKNLIKPGA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.