NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0163149_10096953

Scaffold Ga0163149_10096953


Overview

Basic Information
Taxon OID3300020596 Open in IMG/M
Scaffold IDGa0163149_10096953 Open in IMG/M
Source Dataset NameFreshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2084
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Lake Vanda, McMurdo Dry Valleys
CoordinatesLat. (o)-77.5281Long. (o)161.59Alt. (m)Depth (m)19
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013273Metagenome / Metatranscriptome272Y

Sequences

Protein IDFamilyRBSSequence
Ga0163149_100969532F013273GGAGLTLEAPPLSINTSMSDRKTSKEIQAEIDALTDQLAATLRLEIAELQEQVDQGEAKYQSVLKRMIGRKIRITLKDDPLYGMESVITGPRGKSKKPMYWWFRTTTGIEAYKAKTSFKLLPLEPSTSEEA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.