NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214246_1001483

Scaffold Ga0214246_1001483


Overview

Basic Information
Taxon OID3300020727 Open in IMG/M
Scaffold IDGa0214246_1001483 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)5629
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019426Metagenome229Y
F041564Metagenome / Metatranscriptome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0214246_10014834F041564GAGGMEYDPSDEKHQEIMEYLVSEGAAILDGIDEDGEAIYQFDMDILEEVMPELHAVMQEDMDQVLVDLYQKSLIEVSYDEDLNAIMSISEQGKVALAEAGFTVDDSEDE
Ga0214246_10014837F019426N/AMNKDGFPRPCPFREDKMKVLIFGSKNWVDYNDLIRQITLLIEDNKSLYPDDKEYLFVHKGTQGAENMVTEYIGKTEKFLRQKGYKIKEEIIRDKSSYSDVTLIESDASIALVFGDCPRNRQCIKLMEAMEFPYRYFAE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.