NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214170_1007065

Scaffold Ga0214170_1007065


Overview

Basic Information
Taxon OID3300020731 Open in IMG/M
Scaffold IDGa0214170_1007065 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2404
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013499Metagenome / Metatranscriptome270N
F016116Metagenome / Metatranscriptome249N
F051691Metagenome / Metatranscriptome143N

Sequences

Protein IDFamilyRBSSequence
Ga0214170_10070653F051691N/AMNDQEIIGEIDRLGEVAGIRKNMCKVMPPLGHRVRTLHTQFTQLTDEEKDLIRPRLENALDKILIMVRKVNHNFQEEEERNTYQDSLINE
Ga0214170_10070654F013499GAGMKDIRTTISGIKGLIMLLQAHQRELASKGEPDPSEGSLETARLAIDQLKEKIEAIVGPEEPTGAEGFEVEVHESEEQSQT
Ga0214170_10070655F016116GAGGMKVKSNLKLKNIQMVEKLAKHERLALYNLTEREIDQLEEELVKQFPKEQFAETYIEMWQIYRDTKAIQIYNLIEAKYPGSHNDEKRAGIWFEIATLFPHRLHELVKP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.