NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214088_1283096

Scaffold Ga0214088_1283096


Overview

Basic Information
Taxon OID3300020814 Open in IMG/M
Scaffold IDGa0214088_1283096 Open in IMG/M
Source Dataset NameGranular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Toronto
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1418
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location NameUniversity of Toronto, Toronto, Ontario, Canada
CoordinatesLat. (o)43.6629Long. (o)-79.3957Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099351Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0214088_12830962F099351N/ASPVKVLVELLFVVSVILICIGAAFGKLDEFVGHPMLAFVLFCGAVFLWYRFQET
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.