Scaffold Ga0214277_11105428

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214277_11105428

Scaffold Ga0214277_11105428

Overview

Basic Information
Taxon OID	3300020818 Open in IMG/M
Scaffold ID	Ga0214277_11105428 Open in IMG/M
Source Dataset Name	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada - LBfeed2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	508
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	University of Toronto, Toronto, Ontario, Canada
Coordinates	Lat. (^o)	43.6629	Long. (^o)	-79.3957	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027342	Metagenome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214277_111054281	F027342	N/A	PGAFADLPHSISDAMEFYPAEEGSSTEKMFWSQYIGAEQPMPLSNQLKQLVELHKAAELAMKDLIVRMWPGEPLPGSYFGLVKWMAHACPRLEVIKQSVCIEGARRAFACAKMHWGKLDAETLVKDGPPKGKEHRYPEMYYDGVMKGAQLVANECPKNIIFD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.