NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210378_10009129

Scaffold Ga0210378_10009129


Overview

Basic Information
Taxon OID3300021073 Open in IMG/M
Scaffold IDGa0210378_10009129 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4260
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9197Long. (o)-106.9492Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021530Metagenome / Metatranscriptome218Y
F043380Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0210378_100091291F043380AGGTGGMAIKGKSKGRTAKAVTRGPKPVYQPVKKPVLAKREFWLVIGTILGVALVVGLVAGFIIERNSTEQDDLEQRMRAAVNTYRGELEPILTTIGQARAPSGFDAFTEFGTAVADLEAETPQAPVDSKALEQTAADTLASAKTALEALQEIDETALIKGK
Ga0210378_100091294F021530GGAVTTTALVWLVVGLLSLTAVLAVLIALIRHVFVLGRAANRFQEEVSPLAREIGELADTTSNRSRRMPRRPGSPP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.