NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206683_10288062

Scaffold Ga0206683_10288062


Overview

Basic Information
Taxon OID3300021087 Open in IMG/M
Scaffold IDGa0206683_10288062 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)841
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6907Long. (o)-122.3448Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000245Metagenome / Metatranscriptome1468Y
F002715Metagenome / Metatranscriptome535Y

Sequences

Protein IDFamilyRBSSequence
Ga0206683_102880621F000245AGGAMKTYSRFKESKLDDKLDKYVSDEIKKRKLAKFPVNATDDIKMRMKPNKPAFKFPSPTGSMMIHVFLRKMLPSKGQPKGVMAFNYQLEDK
Ga0206683_102880622F002715GAGGMAEEELQTVKLEVGLLKNEVEIRGKQVEVLLQKLDLTTDKLQQLTVQIIKLNTRQEDYLRHSSTMTDEFKILHTRIGDLHDKQLAANKEIEERIDHLDQYKSKLMGMIIVVGGVVGTIVATVVSHFVKD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.