NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210377_10000143

Scaffold Ga0210377_10000143


Overview

Basic Information
Taxon OID3300021090 Open in IMG/M
Scaffold IDGa0210377_10000143 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)66752
Total Scaffold Genes54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9208Long. (o)-106.9484Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001750Metagenome / Metatranscriptome642Y
F081677Metagenome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0210377_1000014320F081677GAGMANRKNDDDIDYRAEGEAPPHEKDDPTAKGYDQAAHSGPSRFGVPEGNGGVFGTTGGGTYQGGLHVDEQEKEKDSTDGGK
Ga0210377_1000014352F001750N/AMPKVSADIPNELSRQIDRIIRDGWFPDQETIVREALMQFVDAKSFLGDSPRLLHRFAADALNDSKPDTALKFVDRALSLSVKQKVTDFTLHQALVELRVQILLVLGREEEALTSLEEAREQFPNSPTIARWIEKLRKNR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.