NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194123_10277053

Scaffold Ga0194123_10277053


Overview

Basic Information
Taxon OID3300021093 Open in IMG/M
Scaffold IDGa0194123_10277053 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)812
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-5.5789Long. (o)29.514Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002488Metagenome / Metatranscriptome554N
F032997Metagenome / Metatranscriptome178N

Sequences

Protein IDFamilyRBSSequence
Ga0194123_102770531F032997N/AMSVTLIAYPLNDSDIEVPYVLDTMGGTDVAITYSISDIEDVTKRRGSFSKTITLPNTPTNEQCFGFAYNIQSFVGGFTPNKKIRAAMWENGVQVFSGVLQLLSMAKTKGKVTYEVGLFTDDVGLYQAIEGNLLVNTVGVTGMNHIPTSGHVSGTWTASGAYSSGYVYGVIDAAGFTDILNVGGG
Ga0194123_102770532F002488N/AFATLTYDKVWAGSFDYVYALNSDYLTDAESSWLIELLRSSQVWLELDGNLVEAVVNANTYQFVTRRNDQLQQLQLEVAVAYKNNIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.