NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214162_1031319

Scaffold Ga0214162_1031319


Overview

Basic Information
Taxon OID3300021108 Open in IMG/M
Scaffold IDGa0214162_1031319 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)922
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047677Metagenome / Metatranscriptome149N
F077297Metagenome / Metatranscriptome117Y
F084221Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0214162_10313192F084221N/AMSNHQQQVAEGVTGAVSSILLSVPAWMVDVEFALKIFCLLLSAAASIFTIYKMRKKR
Ga0214162_10313193F047677N/AMKWLRSIFSNEGDASSKRVASIVTLLVCINLSYIGTFTEYKCPEYMFDGLLLLAGGGLGLTVIESIFGKKKSNDSTGEGTN
Ga0214162_10313194F077297N/AMTQQAKEQIKAAVIIIVALSICITIQLLYIALKDSKKAIEGYERRADRATHVIDSLEATNVQRMLEIEQLNVQLERNKERYEANISAIDSLDRNGLKRAMHNLLSSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.