Scaffold Ga0214199_1001903

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214199_1001903

Scaffold Ga0214199_1001903

Overview

Basic Information
Taxon OID	3300021124 Open in IMG/M
Scaffold ID	Ga0214199_1001903 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	3381
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Trout Bog, Vilas County, Wisconsin, USA
Coordinates	Lat. (^o)	46.041	Long. (^o)	-89.686	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009449	Metagenome / Metatranscriptome	317	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214199_100190310	F009449	AGGAG	MAKHDDIKEDKKLIKKAFSMHDKQEHPGKHTNLSKLKKGGPTGKDMRSVGRNMARAKNQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.