NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214163_1003484

Scaffold Ga0214163_1003484


Overview

Basic Information
Taxon OID3300021141 Open in IMG/M
Scaffold IDGa0214163_1003484 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6122
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002489Metagenome / Metatranscriptome554Y
F003643Metagenome / Metatranscriptome475N
F021111Metagenome / Metatranscriptome220Y

Sequences

Protein IDFamilyRBSSequence
Ga0214163_100348410F002489GGAGMTENEKPQNLEDNLPMVNYIMLHRIYDLLTLIANKLVGPEDVSKMVEYHNQGYLLGPAPSFTPEQEETE
Ga0214163_10034844F003643AGGAGGMKQDLNNDGKVTMQEKILAALSSYGRHFLGATIALYMTGNTDPGDLIKGGIAACLPVILKALNSNEPAFGFTKK
Ga0214163_10034849F021111GGAMDNLNQPLIQTDGGQIKETDQMGREKFWEDMGRPDDGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.