NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210406_10004992

Scaffold Ga0210406_10004992


Overview

Basic Information
Taxon OID3300021168 Open in IMG/M
Scaffold IDGa0210406_10004992 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14016
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (94.12%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000465Metagenome / Metatranscriptome1105Y
F005065Metagenome / Metatranscriptome413Y
F014401Metagenome / Metatranscriptome263Y
F018222Metagenome / Metatranscriptome236Y

Sequences

Protein IDFamilyRBSSequence
Ga0210406_1000499212F000465GGAGMKAVATKKGLGQEKPAGFREMGTLRCDGCGEEFSIGHDPAFVDKWLAEKQAYWLERVLAEEHERDKKHADRIELPD
Ga0210406_1000499213F018222AGGAGMLRDPRQTWRYFAQAVIQEDDPARVTYLMQQLYRELKENQEEPSRA
Ga0210406_1000499214F005065GGAGMDANHISERLSSMRLEISDLRVATARYWSKSQPTPLDKSAFALGKGRLVEIKRELSDMMKRCA
Ga0210406_1000499215F014401GGAGMNSGTLGPPHKRVWTQLYKAALFELDANKVSERIAEAETALVTRARELFHSGGDNIEEEQAVDDAMYALHALRSALKCRANAKTTSEDLAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.