NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210405_10000184

Scaffold Ga0210405_10000184


Overview

Basic Information
Taxon OID3300021171 Open in IMG/M
Scaffold IDGa0210405_10000184 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)88678
Total Scaffold Genes78 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)60 (76.92%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004121Metagenome / Metatranscriptome452Y
F009088Metagenome / Metatranscriptome323Y
F013787Metagenome / Metatranscriptome268Y
F060154Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0210405_1000018426F009088AGAAGGMENSRVDELRAEVSQLLKKQSEVLESRTFGAATDTEILEFEIRREVIQEICHQLANATSV
Ga0210405_1000018427F004121GAGVARRRKVLAAAALWGACAWFVSLDVDFLVTRLRNAPHWLLQGSRALFMGVSVAIGYAIYRKYLLELRTRSQKYAEIREQIRRLLADLLTTPDEDLIRHLHRTIKRIERLLKRYDPQAPHLDVEPKKPKAA
Ga0210405_100001846F013787GGAGGMSAVGDGEFLRLLKKDIDYFERAVERFEDLIPRVCAPVQDQWRLQAQSRRNFSLELEILLEKAENCVSGSVSLDKNKKHPDSASW
Ga0210405_1000018478F060154N/AAGNGKSGYTFAVTPGGTALTGWNFYTTAVPLSNVTGTKSFCAGDDGVVRTAAPGVITAVAGYAACLALTPMNN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.