 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300021254 Open in IMG/M |
| Scaffold ID | Ga0223824_10472041 Open in IMG/M |
| Source Dataset Name | Sheep rumen microbial communities from New Zealand - Tag 1494 SPADES assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1041 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | New Zealand | |||||||
| Coordinates | Lat. (o) | -42.26 | Long. (o) | 171.6 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074260 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0223824_104720412 | F074260 | N/A | MAEKKTAKKATKKTDELLPFDELPIVVKRNRRNLYEYIRTGELP |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |