Scaffold Ga0223826_10000004

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0223826_10000004

Scaffold Ga0223826_10000004

Overview

Basic Information
Taxon OID	3300021256 Open in IMG/M
Scaffold ID	Ga0223826_10000004 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from New Zealand - Tag 1283 SPADES assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	435272
Total Scaffold Genes	682 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	90 (13.20%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Cattle And Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location
Location Name	New Zealand
Coordinates	Lat. (^o)	-42.26	Long. (^o)	171.6	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091120	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0223826_10000004416	F091120	GAGG	MITHDLKTIVKGSAILDCVKSGGIAVYHITVEDGTVYSLDIDLSDKHDVGETATFMSHYDKALILMRWIRRAIDNETLYKIS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.