NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213904_100252

Scaffold Ga0213904_100252


Overview

Basic Information
Taxon OID3300021262 Open in IMG/M
Scaffold IDGa0213904_100252 Open in IMG/M
Source Dataset NameSwitchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Shaw_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1757
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Switchgrass-Associated Microbial Communities From Reclaimed Mine Lands Soil In West Virginia, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)38.083Long. (o)-81.98Alt. (m)Depth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025567Metagenome201Y

Sequences

Protein IDFamilyRBSSequence
Ga0213904_1002522F025567N/AAAPVVVKAAKAVEKRARRPRTRVTSSGPVVANWFSQEKARPSSFIPAPPRAEAPSLVAAPPASSDRLIRPEELHELAVRTVPVRVDVEQGAGRVFISVNPQEATLRTGEGIEWDFRYLNGADVIVDEIIIEFDRPSPFGTQSFKSRKPGAARPHRQMSGGVSQASAGKRLQYTIRAMTAFKTELANIKPFVTIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.