NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206692_1095206

Scaffold Ga0206692_1095206


Overview

Basic Information
Taxon OID3300021350 Open in IMG/M
Scaffold IDGa0206692_1095206 Open in IMG/M
Source Dataset NameMetatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)721
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.6907Long. (o)-122.3448Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008747Metagenome / Metatranscriptome328Y
F032291Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0206692_10952061F032291N/AEVKEETAINIPLIAPVEESKIKPVGSVGEADQEVTVPPVIDGVTVVMAVPFVNVNEFGLYAKEDGVTSLTTMVTVAVSLPPVLVAVTV
Ga0206692_10952062F032291AGGAVTSVGVPLMVPVEESIANPAGRDGEIDQEVTGPPLVVGVTVVMAVPFVSVNELGLYVREGGATSLTTMVTVTESLPPVLLPVTV
Ga0206692_10952063F008747AGGAVTVVGIPLMAPVDESNAKPAGSDGETDHDVIVPPLEVGVAVVMVVPLVRVKEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.