NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213872_10026665

Scaffold Ga0213872_10026665


Overview

Basic Information
Taxon OID3300021361 Open in IMG/M
Scaffold IDGa0213872_10026665 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2654
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.2822Long. (o)-43.5936Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011605Metagenome / Metatranscriptome289Y
F048807Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0213872_100266652F011605AGGMVTSVTVDDLFERILKVHAGDAGASVGCNLEPDYCPDWFWRLEWSDRFTLTMINFFLVEEMGLSPASYNDLTPYADGNSSATRYYKWRPCRPELGSYYSNHWFLEWLSALTGNAYQLHLLTAPRDSDIWIYAKFDLDIFLTWGNERLDGEDCHFLSPSLSHWRALIDRIVQGESGPLAV
Ga0213872_100266653F048807N/AMVTSLHSKWAVGKARGGRISEAIRNRRATQPPAHFQRNPAGRGRLAVFPRCSLDPYEFRYGRFARALKNSQLTCGDVTIICETVH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.