NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213861_10059622

Scaffold Ga0213861_10059622


Overview

Basic Information
Taxon OID3300021378 Open in IMG/M
Scaffold IDGa0213861_10059622 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2412
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-6(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050274Metagenome / Metatranscriptome145Y
F061764Metagenome / Metatranscriptome131Y
F104749Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0213861_100596223F061764GGCGGMEWRVYILTGGKRFTYYATRSKAEALDKLAIVQRRHGLGAYEYEIEPVIFN
Ga0213861_100596226F050274GGAGMKYEKQARALIRKMIRSARQDWATSVYVRPYGDDETINERQNEREILDAVFCCDETVIRFVDITTGRNLGSVLVVLEYDRQPDEIISDYTDNPYTQRLIDLIGA
Ga0213861_100596228F104749GGAMSDQLENNIRDGLTDYTAQFKESRDRLRAIHTAERESRAKARNRRAILQTVSDLIESVFMALGIFLSVAIVVTILLFAAFGFTAPDGFGIQLPFCGYFWESI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.