Scaffold Ga0213875_10001825

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0213875_10001825

Scaffold Ga0213875_10001825

Overview

Basic Information
Taxon OID	3300021388 Open in IMG/M
Scaffold ID	Ga0213875_10001825 Open in IMG/M
Source Dataset Name	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13244
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (76.92%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location Name	Brazil: Minas Gerais
Coordinates	Lat. (^o)	-19.2822	Long. (^o)	-43.5936	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008041	Metagenome / Metatranscriptome	340	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0213875_100018252	F008041	GGA	MHDRLFQSEEFGTAGPATATIIFICPYGTPIEKVQFAIRRLLRGGYHVVAYQTTAEVFMAADPGILPELIAGVREDIRSRIDALTAAGVTEFGFFGSSLGSFILYNCVGDAIPEFRWGVFNTGGNIARGLWTMADLRQAHVARGWSLPGLEEAWAALQWPAFGDLEGCRFVFSSSRRDGAAPLRDIEQYLGPMLRAGADVRVHEVPAWSHRTTVIAGLVLAPKLVRMVTKDRAAGRGHARMNLASRVRSR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.