NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193750_1000052

Scaffold Ga0193750_1000052


Overview

Basic Information
Taxon OID3300021413 Open in IMG/M
Scaffold IDGa0193750_1000052 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)49616
Total Scaffold Genes58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)37 (63.79%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8924Long. (o)-106.9111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011684Metagenome288Y
F012903Metagenome / Metatranscriptome276N

Sequences

Protein IDFamilyRBSSequence
Ga0193750_100005215F012903AGGMKATLIILTMLASALAASAQQPVTATTEDGRKVLLYPNGQWRLLRGTAPQVDHSVSQEGVQDHIYEFIQDYTIGSGQASIRFRRGERYRGRIFTNHHAEVDVNGVSYSVPRGVLSDKHLD
Ga0193750_100005231F011684AGGVRRAPFALLVFVVASAFAKSTAPEVIFISPCECQEFHGKNRWIVKTDFTPVPLDKSAIQSVTPSQIYAWEGLEADVDLTPYSEARMPSEEKWCALTGRVVDAKVEADGDIHIALELPARR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.